logo
Gene information for gene 145698224
GI145698224
Operon ID3075
Strand+
Start380575
End380940
Length121
Synonymb0360
GeneinsC
ProductIS2 repressor TnpA
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYGRAKKWIAHAPLLPGDG
E