logo
Gene information for gene 145698241
GI145698241
Operon ID3228
Strand+
Start1202491
End1203048
Length185
Synonymb1147
GeneymfL
Producte14 prophage; predicted DNA-binding transcriptional regulator
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MGKHHWKIEKQPEWYVKAVRKTIAALPSGYAEAADWLDVTENALFNRLRADGDQIFPLGWAMVLQRAGGTHFIADAVAQSANGVFVSLPDVEDVDNADINQRLLEVIEQIGSYSKQIRSA
IEDGVVEPHEKTAINDELYLSISKLQEHAALVYKIFCISESNDARECAAPGVVASIASGCGETNA