logo
Gene information for gene 145698245
GI145698245
Operon ID1382487
Strand+
Start1228038
End1228499
Length153
Synonymb1181
GeneycgN
Productconserved protein
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MAEHLMSDVPFWQSKTLDEMSDAEWESLCDGCGQCCLHKLMDEDTDEIYFTNVACRQLNIKTCQCRNYERRFEFEPDCIKLTRENLPTFEWLPMTCAYRLLAEGKDLPAWHPLLTGSKAA
MHGERISVRHIAVKESEVIDWQDHILNKPDWAQ