logo
Gene information for gene 145698248
GI145698248
Operon ID1382489
Strand+
Start1273007
End1274401
Length464
Synonymb1220
GeneychO
Productpredicted invasin
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MSRFVPRIIPFYLLLLVAGGTANAQSTFEQKAANPFDNNNDGLPDLGMAPENHDGEKHFAEIVKDFGETSMNDNGLDTGEQAKAFALGKVRDALSQQVNQHVESWLSPWGNASVDVKVDN
EGHFTGSRGSWFVPLQDNDRYLTWSQLGLTQQDNGLVSNVGVGQRWARGNWLVGYNTFYDNLLDENLQRAGFGAEAWGEYLRLSANFYQPFAAWHEQTATQEQRMARGYDLTARMRMPFY
QHLNTSVSLEQYFGDRVDLFNSGTGYHNPVALSLGLNYTPVPLVTVTAQHKQGESGENQNNLGLNLNYRFGVPLKKQLSAGEVAESQSLRGSRYDNPQRNNLPTLEYRQRKTLTVFLATP
PWDLKPGETVPLKLQIRSRYGIRQLIWQGDTQILSLTPGAQANSAEGWTLIMPDWQNGEGASNHWRLSVVVEDNQGQRVSSNEITLTLVEPFDALSNDELRWEP