logo
Gene information for gene 145698250
GI145698250
Operon ID1382491
Strand+
Start1306812
End1306985
Length57
Synonymb4595
GeneyciY
Producthypothetical protein
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MKRSRTEVGRWRMQRQASRRKSRWLEGQSRRNMRIHSIRKCILNKQRNSLLFAIYNI