logo
Gene information for gene 145698251
GI145698251
Operon ID3248
Strand+
Start1333315
End1333482
Length55
Synonymb4523
GeneyciX
Producthypothetical protein
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MVGQEQLESSPLCQHSDNETETKRECSVVIPDDWQLTSQQQAFIELFAEDDQPKQ