logo
Gene information for gene 145698252
GI145698252
Operon ID1382492
Strand-
Start1342460
End1342633
Length57
Synonymb4596
GeneyciZ
Producthypothetical protein
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MSEFDAQRVAERIDIVLDILVAGDYHSAIHNLEILKAELLRQVAESTPDIPKAPWEI