logo
Gene information for gene 145698254
GI145698254
Operon ID3269
Strand-
Start1466808
End1467173
Length121
Synonymb1403
GeneinsC
ProductIS2 repressor TnpA
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYGRAKKWIAHAPLLPGDG
E