logo
Gene information for gene 16128346
GI16128346
Operon ID3075
Strand+
Start380898
End381803
Length301
Synonymb0361
GeneinsD
ProductIS2 transposase TnpB
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRV
AVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTI
KRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLEI