logo
Gene information for gene 16128473
GI16128473
Operon ID3100
Strand-
Start514080
End514997
Length305
Synonymb0489
GeneqmcA
Productmulticopy suppressor of ftsH htpX double mutant; membrane-anchored predicted protease with C-terminal cytoplasmic PHB domain
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGLSLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNLELAIINLTMTNIRTVL
GSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVRPPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQAEARERSAEAEARATKMVS
EAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEASSLMGSIAGIAELVKDSANKRTQP