logo
Gene information for gene 16128533
GI16128533
Operon ID3115
Strand+
Start572594
End572956
Length120
Synonymb0550
GenerusA
ProductDLP12 prophage; endonuclease RUS
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE