logo
Gene information for gene 16128917
GI16128917
Operon ID3191
Strand+
Start1011224
End1012477
Length417
Synonymb0950
GenepqiA
Productparaquat-inducible membrane protein A
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MCEHHHAAKHILCSQCDMLVALPRLEHGQKAACPRCGTTLTVAWDAPRQRPTAYALAALFMLLLSNLFPFVNMNVAGVTSEITLLEIPGVLFSEDYASLGTFFLLFVQLVPAFCLITILL
LVNRAELPVRLKEQLARVLFQLKTWGMAEIFLAGVLVSFVKLMAYGSIGVGSSFLPWCLFCVLQLRAFQCVDRRWLWDDIAPMPELRQPLKPGVTGIRQGLRSCSCCTAILPADEPVCPR
CSTKGYVRRRNSLQWTLALLVTSIMLYLPANILPIMVTDLLGSKMPSTILAGVILLWSEGSYPVAAVIFLASIMVPTLKMIAIAWLCWDAKGHGKRDSERMHLIYEVVEFVGRWSMIDVF
VIAVLSALVRMGGLMSIYPAMGALMFALVVIMTMFSAMTFDPRLSWDRQPESEHEES