logo
Gene information for gene 94541097
GI94541097
Operon ID3115
Strand+
Start572953
End573093
Length46
Synonymb4509
GeneylcG
Productexpressed protein, DLP12 prophage
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MMFEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTGAGV