logo
Gene information for gene 94541107
GI94541107
Operon ID3248
Strand+
Start1333184
End1333312
Length42
Synonymb4522
GeneymiA
Producthypothetical protein
SpeciesEscherichia coli str. K-12 substr. MG1655
Sequence
MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG